Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM2 Peptide - middle region

CHRM2 Peptide - middle region

Product Specifications

Product Name Alternative

HM2

UniProt

P08172

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000730.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SCNN1B (Thr615) Rabbit Polyclonal Antibody (PE-Cy7)
orb893958 100 µL

Phospho-SCNN1B (Thr615) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
EXOSC6 CRISPR Activation Plasmid (h)
sc-405680-ACT 20 µg

EXOSC6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Klf17 shRNA (UAS) - Lentiviral mouse Klf17 shRNA (UAS) plasmid
GTR15209263 1 Vial

Lentiviral mouse Klf17 shRNA (UAS) - Lentiviral mouse Klf17 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Anti-Inactive DUSP27 antibody
SL14458R-01 50 µL

Rabbit Anti-Inactive DUSP27 antibody

Sign In for Pricing
View Details
Rabbit Anti-Inactive DUSP27 antibody
SL14458R-02 100 µL

Rabbit Anti-Inactive DUSP27 antibody

Sign In for Pricing
View Details
ELISA Kit for Complement Component 7 (C7)
TRV-0063969-01 24 Tests

ELISA Kit for Complement Component 7 (C7)

Sign In for Pricing
View Details