Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000180.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 (ABI1) Mouse Monoclonal Antibody [Clone ID: 1B9]
AM26490AF-N 100 µL

SSH3BP1 (ABI1) Mouse Monoclonal Antibody [Clone ID: 1B9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS626831 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
CLIC4 (NM_013943) Human Over-expression Lysate
LY402262 100 µg

CLIC4 (NM_013943) Human Over-expression Lysate

Sign In for Pricing
View Details
FADD Recombinant Rabbit monoclonal Antibody
HA750689 100 µL

FADD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
9-[(3aS,4S,6S,6aR)-3a,6-Dihydroxyhexahydro-1H-cyclopenta[c]furan-4-yl]guanine
TRC-D110580-5MG 5 mg

9-[(3aS,4S,6S,6aR)-3a,6-Dihydroxyhexahydro-1H-cyclopenta[c]furan-4-yl]guanine

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF405S conjugate, 0.1mg/mL
BNC042951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details