Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000180.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit
E-MSEL-M0102-01 24 Tests

Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit
E-MSEL-M0102-02 48 Tests

Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit
E-MSEL-M0102-03 96 Tests

Mini Sample Mouse Tie-2 (TEK Tyrosine Kinase, Endothelial) ELISA Kit

Sign In for Pricing
View Details
Human GLIS1 activation kit by CRISPRa
GA115692 1 Kit

Human GLIS1 activation kit by CRISPRa

Sign In for Pricing
View Details
21-Dehydro Cloprednol
TRC-D229175-25MG 25 mg

21-Dehydro Cloprednol

Sign In for Pricing
View Details
FOXO1 Mouse Monoclonal Antibody [Clone ID: 3B6]
AM06731PU-N 100 µg

FOXO1 Mouse Monoclonal Antibody [Clone ID: 3B6]

Sign In for Pricing
View Details