Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - C-terminal region

RPA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

P15927

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN4 (N-term) Rabbit Polyclonal Antibody
AP23278PU-N 100 µg

KCNN4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PTCH2 activation kit by CRISPRa
GA105726 1 Kit

Human PTCH2 activation kit by CRISPRa

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF488A conjugate, 0.1mg/mL
BNC882755-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-2-Deoxy-1-Alpha-(2-Naphthyl-1,3,4,5,6,7,8-d7)-Glucopyranoside
TRC-A605651-2.5MG 2.5 mg

2-Amino-2-Deoxy-1-Alpha-(2-Naphthyl-1,3,4,5,6,7,8-d7)-Glucopyranoside

Sign In for Pricing
View Details
Cresyl violet *CAS 41830-80-2*
90-AAT 100 mg

Cresyl violet *CAS 41830-80-2*

Sign In for Pricing
View Details
3-Cyclohexenylcarboxylic Acid
TRC-C988195-1G 1 g

3-Cyclohexenylcarboxylic Acid

Sign In for Pricing
View Details