Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - C-terminal region

RPA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

P15927

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Nitrophenyl)malondialdehyde
TRC-N545413-500MG 500 mg

2-(2-Nitrophenyl)malondialdehyde

Sign In for Pricing
View Details
VILL Rabbit Polyclonal Antibody
TA369758 100 µL

VILL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Acetamido-1-N-(b-L-aspartyl)-2-deoxy-b-D-glucopyranosylamine
TRC-A790113-2MG 2 mg

2-Acetamido-1-N-(b-L-aspartyl)-2-deoxy-b-D-glucopyranosylamine

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-328
BPIP-328 1 Unit

Variable Volume 12 Channel Micropipette BPIP-328

Sign In for Pricing
View Details
Crebbp Mouse Gene Knockout Kit (CRISPR)
KN303812 1 Kit

Crebbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant LYZ Antibody
RC-6004-01 50 μL

Recombinant LYZ Antibody

Sign In for Pricing
View Details