What is the catalog number for BBS4 Peptide - N-terminal region?

The catalog number for BBS4 Peptide - N-terminal region is orb1999198.

What sizes are available for BBS4 Peptide - N-terminal region?

BBS4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is BBS4 Peptide - N-terminal region in stock?

BBS4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BBS4 Peptide - N-terminal region

Product Specifications

UniProt

Q96RK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239607.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

27961031 100 µg

MAGOH2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing

View Details

A00345-1-FITC 100 µg/Vial

Anti-BAP1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing

View Details

EIA07683Rb 1 Kit

Rabbit Staphylococal protein A (SPA) ELISA Kit

Sign In for Pricing

View Details

A13524-1 1 mg

NSC 663284 1mg

Sign In for Pricing

View Details

sc-94353-SH 20 µg

PCGF1 shRNA Plasmid (h)

Sign In for Pricing

View Details

NEB N0445L 1.5 µmol

7-deaza dGTP

Sign In for Pricing

View Details