What is the catalog number for BBS4 Peptide - N-terminal region?

The catalog number for BBS4 Peptide - N-terminal region is orb1999198.

What sizes are available for BBS4 Peptide - N-terminal region?

BBS4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is BBS4 Peptide - N-terminal region in stock?

BBS4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BBS4 Peptide - N-terminal region

Product Specifications

UniProt

Q96RK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239607.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E28PN6191 100 µL

Tom22 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

MBS7040982-01 0.02 mg

Recombinant Uncharacterized protein Mb2102c (Mb2102c)

Sign In for Pricing

View Details

MBS7040982-02 0.1 mg

Recombinant Uncharacterized protein Mb2102c (Mb2102c)

Sign In for Pricing

View Details

MBS7040982-03 5x 0.1 mg

Recombinant Uncharacterized protein Mb2102c (Mb2102c)

Sign In for Pricing

View Details

TL705233 1 Kit

Xpa Rat shRNA Plasmid (Locus ID 298074)

Sign In for Pricing

View Details

TA342785 100 µL

ADAM8 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details