Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1 Peptide - middle region

CAMK1 Peptide - middle region

Product Specifications

Product Name Alternative

CAMKI

UniProt

Q8IU85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAPB Human Gene Knockout Kit (CRISPR)
KN400517 1 Kit

VAPB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFP, AlpHcAbs® Mouse
HA710232 100 µg

GFP, AlpHcAbs® Mouse

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL
BNC471025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMEK2 (PPP4R3B) Rabbit Polyclonal Antibody
TA361705 100 µL

SMEK2 (PPP4R3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565596 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
9-Dehydroandrostenedione
TRC-D229365-50MG 50 mg

9-Dehydroandrostenedione

Sign In for Pricing
View Details