Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1 Peptide - middle region

CAMK1 Peptide - middle region

Product Specifications

Product Name Alternative

CAMKI

UniProt

Q8IU85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin-1 (CNN1/832), 0.2mg/mL
BNUB0832-100 1x 100 µL

Calponin-1 (CNN1/832), 0.2mg/mL

Sign In for Pricing
View Details
TSGA13 (C-term) Rabbit Polyclonal Antibody
AP54372PU-N 400 µL

TSGA13 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
tert-Butyl 4-Iodobenzoate
TRC-B692420-500MG 500 mg

tert-Butyl 4-Iodobenzoate

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF488A conjugate, 0.1mg/mL
BNC880904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF23 (NM_175769) Human Recombinant Protein
TP321910M 100 µg

TCF23 (NM_175769) Human Recombinant Protein

Sign In for Pricing
View Details
Androgen Receptor Antibody
KC-19565-01 50 μL

Androgen Receptor Antibody

Sign In for Pricing
View Details