What is the catalog number for P3H1 Peptide - middle region?

The catalog number for P3H1 Peptide - middle region is orb1999176.

What sizes are available for P3H1 Peptide - middle region?

P3H1 Peptide - middle region is available in the following size(s): 100 µg.

Is P3H1 Peptide - middle region in stock?

P3H1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

P3H1 Peptide - middle region

Product Specifications

Product Name Alternative

OI8, GROS1, LEPRE1

UniProt

Q32P28

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC417600 20 µg

MYO1E (NM_004998) Human Over-expression Lysate

Sign In for Pricing

View Details

sc-425675-NIC-2 20 µg

MOAP1 Double Nickase Plasmid (m2)

Sign In for Pricing

View Details

SI107499B 1 Each

Mouse Lemd3 Pre-designed siRNA Set B

Sign In for Pricing

View Details

E1411Mo-01 48 Well

Mouse Muscle-specific RING finger protein 1, MuRF1 ELISA KIT

Sign In for Pricing

View Details

E1411Mo-02 96 Well

Mouse Muscle-specific RING finger protein 1, MuRF1 ELISA KIT

Sign In for Pricing

View Details

E1411Mo-03 5x 96 Tests

Mouse Muscle-specific RING finger protein 1, MuRF1 ELISA KIT

Sign In for Pricing

View Details