Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P3H1 Peptide - middle region

P3H1 Peptide - middle region

Product Specifications

Product Name Alternative

OI8, GROS1, LEPRE1

UniProt

Q32P28

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN-αB Double Nickase Plasmid (m)
sc-421046-NIC 20 µg

IFN-αB Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SOHLH2 Polyclonal Antibody, PerCP Conjugated
bs-12279R-PerCP 100 µL

SOHLH2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human HDAC10 (NM_032019) AAV Particle
RC218536A1V 250 µL

Human HDAC10 (NM_032019) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Ccr2 shRNA (UAS) - Lentiviral mouse Ccr2 shRNA (UAS, RFP) plasmid
GTR15201337 1 Vial

Lentiviral mouse Ccr2 shRNA (UAS) - Lentiviral mouse Ccr2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MID1IP1 Antibody
E19-9624-1 50 µg - 50 µL

MID1IP1 Antibody

Sign In for Pricing
View Details
Jmjd1c-set siRNA/shRNA/RNAi Lentivector (Mouse)
25244094 4x 500 ng

Jmjd1c-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details