Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P3H1 Peptide - middle region

P3H1 Peptide - middle region

Product Specifications

Product Name Alternative

OI8, GROS1, LEPRE1

UniProt

Q32P28

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC26010 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
27057061 1.0 µg DNA

LOC26010 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BIN1 (NM_139346) Human Tagged ORF Clone Lentiviral Particle
RC214277L1V 200 µL

BIN1 (NM_139346) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KRTAP4-9 Adenovirus (Human)
26193051 1.0 mL

KRTAP4-9 Adenovirus (Human)

Sign In for Pricing
View Details
Phospho-MAPKAPK2 (Thr222) Rabbit Polyclonal Antibody (PerCP)
orb2432146 100 µL

Phospho-MAPKAPK2 (Thr222) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Human TP/TXA2R (Thromboxane Receptor) ValidElisa Kit
EK340783 96 Well

Human TP/TXA2R (Thromboxane Receptor) ValidElisa Kit

Sign In for Pricing
View Details
Recombinant Human SCO1 Protein
NBP2-51935-0.1mg 0.1 mg

Recombinant Human SCO1 Protein

Sign In for Pricing
View Details