Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH5 Peptide - middle region

DPH5 Peptide - middle region

Product Specifications

Product Name Alternative

AD-018, CGI-30, NPD015, HSPC143

UniProt

Q9H2P9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD113/NECTIN3 Polyclonal Antibody
PTX19860-01 50 µg

Anti-CD113/NECTIN3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD113/NECTIN3 Polyclonal Antibody
PTX19860-02 100 µg

Anti-CD113/NECTIN3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD113/NECTIN3 Polyclonal Antibody
PTX19860-03 1 mg

Anti-CD113/NECTIN3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MYH4 Antibody
A09143-1 100 µL

Anti-MYH4 Antibody

Sign In for Pricing
View Details
SLC25A5 Protein Vector (Rat) (pPM-C-HA)
PV305704 500 ng

SLC25A5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CLTCL1 Conjugated Antibody
orb1614168 100 µL

CLTCL1 Conjugated Antibody

Sign In for Pricing
View Details