Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPH5 Peptide - middle region

DPH5 Peptide - middle region

Product Specifications

Product Name Alternative

AD-018, CGI-30, NPD015, HSPC143

UniProt

Q9H2P9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc-Tag Monoclonal Antibody (3E8), Cy3 Conjugated
RA11714-01 50 µL

Myc-Tag Monoclonal Antibody (3E8), Cy3 Conjugated

Sign In for Pricing
View Details
Myc-Tag Monoclonal Antibody (3E8), Cy3 Conjugated
RA11714-02 100 µL

Myc-Tag Monoclonal Antibody (3E8), Cy3 Conjugated

Sign In for Pricing
View Details
Rabbit Hsp27 (Heat Shock Protein 27) ELISA Kit
ERb22505 96 Tests

Rabbit Hsp27 (Heat Shock Protein 27) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Eefsec shRNA (UAS) - Lentiviral mouse Eefsec shRNA (UAS, iRFP) plasmid
GTR15239368 1 Vial

Lentiviral mouse Eefsec shRNA (UAS) - Lentiviral mouse Eefsec shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Naip2 Protein Vector (Mouse) (pPB-N-His)
PV204031 500 ng

Naip2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-SG494 SGK494 Antibody
A16654 100 µL

Anti-SG494 SGK494 Antibody

Sign In for Pricing
View Details