PIP5K1A Peptide - middle region
PIP5K1A Peptide - middle region
Product Specifications
UniProt
Q99755
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001129108.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6127917-01 0.1 mL
Cancer Antigen CA19-9 (Gastrointestinal Cancer) (FITC)
Sign In for Pricing
View Details MBS6127917-02 5x 0.1 mL
Cancer Antigen CA19-9 (Gastrointestinal Cancer) (FITC)
Sign In for Pricing
View Details 
039827-ML650 100 µL
PDGFRL, NT (PDGFRL, PRLTS, Platelet-derived growth factor receptor-like protein, PDGF receptor beta-like tumor suppressor) (MaxLight 650) discontinued
Sign In for Pricing
View Details