Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP5K1A Peptide - middle region

PIP5K1A Peptide - middle region

Product Specifications

UniProt

Q99755

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129108.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IFN-α ELISA Kit
EMI0350 96 Tests

Mouse IFN-α ELISA Kit

Sign In for Pricing
View Details
PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1) (MaxLight 650)
MBS6229281-01 0.1 mL

PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1) (MaxLight 650)

Sign In for Pricing
View Details
PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1) (MaxLight 650)
MBS6229281-02 5x 0.1 mL

PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Anti-Human UBE2D3 pAb
PA8266-01 50 μL

Rabbit Anti-Human UBE2D3 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human UBE2D3 pAb
PA8266-02 100 μL

Rabbit Anti-Human UBE2D3 pAb

Sign In for Pricing
View Details
FMN1 Antibody (Center) [APR33283G]
APR33283G-01 50 µL

FMN1 Antibody (Center) [APR33283G]

Sign In for Pricing
View Details