Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP11 Peptide - C-terminal region

DUSP11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PIR1

UniProt

O75319

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003575.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR2 Antibody (OABF00783-100UL)
OABF00783-100UL 100 µL

CXCR2 Antibody (OABF00783-100UL)

Sign In for Pricing
View Details
Glucose BSA Colloidal Gold Conjugate, 1mL 40nm
CCG-0002-40 1 mL

Glucose BSA Colloidal Gold Conjugate, 1mL 40nm

Sign In for Pricing
View Details
RBM17 (NM_001145547) Human Tagged Lenti ORF Clone
RC227492L3 10 µg

RBM17 (NM_001145547) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IFluor® 820 Anti-human CD56 Antibody *My31*
105620P0-AAT 100 Tests

IFluor® 820 Anti-human CD56 Antibody *My31*

Sign In for Pricing
View Details
Recombinant Human VEGF-D Protein
orb2995034-01 10 µg

Recombinant Human VEGF-D Protein

Sign In for Pricing
View Details
Recombinant Human VEGF-D Protein
orb2995034-02 50 µg

Recombinant Human VEGF-D Protein

Sign In for Pricing
View Details