DUSP11 Peptide - C-terminal region
DUSP11 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PIR1
UniProt
O75319
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003575.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
B8638 96 Tests
Β-soluble NSF attachment protein (NAPB) Mouse ELISA Kit
Sign In for Pricing
View Details 
sc-476259 1 mg
N- (Propyl (2- (2,4,6-trichlorophenoxy) ethyl) carbamoyl) formamide-d7
Sign In for Pricing
View Details 
JL51041-01 48 Tests
Rabbit Toxoplasma Gondii Antibody (Tox-Ab) ELISA Kit
Sign In for Pricing
View Details JL51041-02 96 Tests
Rabbit Toxoplasma Gondii Antibody (Tox-Ab) ELISA Kit
Sign In for Pricing
View Details 
K7378508 1.0 µg DNA
Olr283 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details