Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0391 Peptide - middle region

KIAA0391 Peptide - middle region

Product Specifications

Product Name Alternative

MRPP3, PRORP

UniProt

O15091

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243607.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgM Isotype Control for In Vivo - Low Endotoxin
ICH2252-100mg 100 mg

Mouse IgM Isotype Control for In Vivo - Low Endotoxin

Sign In for Pricing
View Details
RAC2 Polyclonal Antibody
E-AB-40245-01 25 µL

RAC2 Polyclonal Antibody

Sign In for Pricing
View Details
RAC2 Polyclonal Antibody
E-AB-40245-02 100 µL

RAC2 Polyclonal Antibody

Sign In for Pricing
View Details
CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9), CF®405M Conjugate - Biotium Choice
P016-405M-125 1x 125 µL

CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details
Nme4 (NM_019731) Mouse Tagged ORF Clone
MG201741 10 µg

Nme4 (NM_019731) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CLEC2D (NM_001004419) Human Over-expression Lysate
LC423748 20 µg

CLEC2D (NM_001004419) Human Over-expression Lysate

Sign In for Pricing
View Details