Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0391 Peptide - middle region

KIAA0391 Peptide - middle region

Product Specifications

Product Name Alternative

MRPP3, PRORP

UniProt

O15091

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243607.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Storage Box
R1020-B 5 Units/Pack

Storage Box

Sign In for Pricing
View Details
Potassium Vinyltrifluoroborate
TRC-P698700-2.5G 2.5 g

Potassium Vinyltrifluoroborate

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), 0.2mg/mL
BNUB1671-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), 0.2mg/mL

Sign In for Pricing
View Details
5T4 (TPBG) Human Gene Knockout Kit (CRISPR)
KN203484RB 1 Kit

5T4 (TPBG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myosin Phosphatase (PPP1R12A) Rabbit Polyclonal Antibody
AP06543PU-N 100 µg

Myosin Phosphatase (PPP1R12A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD34 Antibody[RAM34]
E-AB-F1284E-01 50 Tests

APC Anti-Mouse CD34 Antibody[RAM34]

Sign In for Pricing
View Details