Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Peptide - middle region

TBC1D22A Peptide - middle region

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL
BNC043086-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Urine Cell-Free Circulating and Viral Nucleic Acid Purification Midi Kit
60000 20 Preparations

Urine Cell-Free Circulating and Viral Nucleic Acid Purification Midi Kit

Sign In for Pricing
View Details
IRF5 (NM_001098627) Human Recombinant Protein
TP315434L 1 mg

IRF5 (NM_001098627) Human Recombinant Protein

Sign In for Pricing
View Details
EFNB2 Polyclonal Antibody
E-AB-14063-01 20 µL

EFNB2 Polyclonal Antibody

Sign In for Pricing
View Details
EFNB2 Polyclonal Antibody
E-AB-14063-02 60 µL

EFNB2 Polyclonal Antibody

Sign In for Pricing
View Details
EFNB2 Polyclonal Antibody
E-AB-14063-03 120 µL

EFNB2 Polyclonal Antibody

Sign In for Pricing
View Details