Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D22A Peptide - middle region

TBC1D22A Peptide - middle region

Product Specifications

Product Name Alternative

C22orf4, HSC79E021

UniProt

Q8WUA7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271232.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mortality Factor 4 like 2 (MORF4L2) (NM_001142418) Human Recombinant Protein
TP326523L 1 mg

Mortality Factor 4 like 2 (MORF4L2) (NM_001142418) Human Recombinant Protein

Sign In for Pricing
View Details
FAM209B (NM_001013646) Human Over-expression Lysate
LY423000 100 µg

FAM209B (NM_001013646) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc7a12 Mouse Gene Knockout Kit (CRISPR)
KN516189 1 Kit

Slc7a12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF568 conjugate, 0.1mg/mL
BNC681062-100 1x 100 µL

FSH beta (FSHb/1062), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AASDH Human qPCR Primer Pair (NM_181806)
HP219027 200 Reactions

AASDH Human qPCR Primer Pair (NM_181806)

Sign In for Pricing
View Details
LIG3 Antibody
KC-36703-01 50 μL

LIG3 Antibody

Sign In for Pricing
View Details