Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC86 Peptide - middle region

CCDC86 Peptide - middle region

Product Specifications

UniProt

Q9H6F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_077003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARG/ARHGEF12 Rabbit Polyclonal Antibody (Biotin)
orb2595451 100 µg

LARG/ARHGEF12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Dynamin-1 (DNM1) ELISA Kit
AE46865HU-01 48 Tests

Human Dynamin-1 (DNM1) ELISA Kit

Sign In for Pricing
View Details
Human Dynamin-1 (DNM1) ELISA Kit
AE46865HU-02 96 Tests

Human Dynamin-1 (DNM1) ELISA Kit

Sign In for Pricing
View Details
EGR1 Antibody [N15L8]
C18363-100uL*2 2x 100μL

EGR1 Antibody [N15L8]

Sign In for Pricing
View Details
Factor VIII discontinued
376335 500 µg

Factor VIII discontinued

Sign In for Pricing
View Details
Porcine Trypsin (TRY) ELISA Kit DIY Materials
MBS2088494-01 5x 96 Tests

Porcine Trypsin (TRY) ELISA Kit DIY Materials

Sign In for Pricing
View Details