Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC86 Peptide - middle region

CCDC86 Peptide - middle region

Product Specifications

UniProt

Q9H6F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_077003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Starch from maize, pregelatinized pure EP, USP (pharma grade)
LC-10090.1 25 Kg

Starch from maize, pregelatinized pure EP, USP (pharma grade)

Sign In for Pricing
View Details
KLK5 Antibody
orb2315219-01 20 µg

KLK5 Antibody

Sign In for Pricing
View Details
KLK5 Antibody
orb2315219-02 100 µg

KLK5 Antibody

Sign In for Pricing
View Details
KLK5 Antibody
orb2315219-03 100 ug (without BSA and Azide)

KLK5 Antibody

Sign In for Pricing
View Details
ANO4 rabbit pAb Antibody
orb2306157-01 50 µL

ANO4 rabbit pAb Antibody

Sign In for Pricing
View Details
ANO4 rabbit pAb Antibody
orb2306157-02 100 µL

ANO4 rabbit pAb Antibody

Sign In for Pricing
View Details