Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDAD1 Peptide - middle region

SDAD1 Peptide - middle region

Product Specifications

UniProt

Q9NVU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275912.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVNVITTACFSKVTKILVAALTFFLGKDEDEKQDSDSESEDDGPTARDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPAS1 Polyclonal Antibody
HA593014-01 50 µg

Anti-EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EPAS1 Polyclonal Antibody
HA593014-02 100 µg

Anti-EPAS1 Polyclonal Antibody

Sign In for Pricing
View Details
Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit
MBS9351228-01 48 Well

Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit

Sign In for Pricing
View Details
Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit
MBS9351228-02 96 Well

Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit

Sign In for Pricing
View Details
Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit
MBS9351228-03 5x 96 Well

Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit

Sign In for Pricing
View Details
Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit
MBS9351228-04 10x 96 Well

Hamster Sperm-Associated Antigen 5 (SPA5) ELISA Kit

Sign In for Pricing
View Details