Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP25 Peptide - middle region

UTP25 Peptide - middle region

Product Specifications

Product Name Alternative

DEF, DIEXF, C1orf107, DJ434O14.5

UniProt

Q68CQ4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055203.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FISLLEGDSKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEGFP-BTBD7 Plasmid
PVT12837 2 µg

pEGFP-BTBD7 Plasmid

Sign In for Pricing
View Details
4- (Piperidin-4-ylcarbonyl) morpholine
OR1003002-01 250 mg

4- (Piperidin-4-ylcarbonyl) morpholine

Sign In for Pricing
View Details
4- (Piperidin-4-ylcarbonyl) morpholine
OR1003002-02 500 mg

4- (Piperidin-4-ylcarbonyl) morpholine

Sign In for Pricing
View Details
Recombinant Human IL-15 Protein
orb3002492-01 10 µg

Recombinant Human IL-15 Protein

Sign In for Pricing
View Details
Recombinant Human IL-15 Protein
orb3002492-02 50 µg

Recombinant Human IL-15 Protein

Sign In for Pricing
View Details
Recombinant Human IL-15 Protein
orb3002492-03 500 µg

Recombinant Human IL-15 Protein

Sign In for Pricing
View Details