Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP25 Peptide - middle region

UTP25 Peptide - middle region

Product Specifications

Product Name Alternative

DEF, DIEXF, C1orf107, DJ434O14.5

UniProt

Q68CQ4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055203.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FISLLEGDSKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD36 Polyclonal Antibody, Cy5 Conjugated
bs-1100R-Cy5-01 20 µL

CD36 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
CD36 Polyclonal Antibody, Cy5 Conjugated
bs-1100R-Cy5-02 100 µL

CD36 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
RTKN antibody - N-terminal region
MBS3212631-01 0.1 mL

RTKN antibody - N-terminal region

Sign In for Pricing
View Details
RTKN antibody - N-terminal region
MBS3212631-02 5x 0.1 mL

RTKN antibody - N-terminal region

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (MMP9) Antibody (ATTO488)
abx449148-01 10x 96 Tests

Matrix Metalloproteinase 9 (MMP9) Antibody (ATTO488)

Sign In for Pricing
View Details
Matrix Metalloproteinase 9 (MMP9) Antibody (ATTO488)
abx449148-02 5x 96 Tests

Matrix Metalloproteinase 9 (MMP9) Antibody (ATTO488)

Sign In for Pricing
View Details