Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHCBP1L Peptide - middle region

SHCBP1L Peptide - middle region

Product Specifications

Product Name Alternative

GE36, C1orf14

UniProt

Q9BZQ2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112195.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAQRFKKTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 / SRY-box 9 (rSOX9/2288), CF647 conjugate, 0.1mg/mL
BNC472288-100 1x 100 µL

SOX9 / SRY-box 9 (rSOX9/2288), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GPX6 activation kit by CRISPRa
GA116892 1 Kit

Human GPX6 activation kit by CRISPRa

Sign In for Pricing
View Details
Cyclo(-Gly-Tyr)
TRC-C987420-250MG 250 mg

Cyclo(-Gly-Tyr)

Sign In for Pricing
View Details
PLCG 2 (PLCG2) pTyr1217 Rabbit Polyclonal Antibody
AP08037PU-N 100 µL

PLCG 2 (PLCG2) pTyr1217 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spark-Free Laboratory Refrigerator BLAR-414
BLAR-414 1 Unit

Spark-Free Laboratory Refrigerator BLAR-414

Sign In for Pricing
View Details
CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein
TP313742 20 µg

CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein

Sign In for Pricing
View Details