Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16ORF58 Peptide - middle region

C16ORF58 Peptide - middle region

Product Specifications

Product Name Alternative

RUS

UniProt

Q96GQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFTMTVSTSNLAKCIVSVAGGATRAALTVHQARRNNMADVSAKDSSQETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/2478), CF405S conjugate, 0.1mg/mL
BNC042478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PFTK1 (CDK14) (M1) Rabbit Polyclonal Antibody
AP52091PU-N 400 µL

PFTK1 (CDK14) (M1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Tcea3 activation kit by CRISPRa
GA204231 1 Kit

Mouse Tcea3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
RDR-PKM2-Mu-01 96 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
RDR-PKM2-Mu-02 48 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
Irganox 1035
TRC-I764153-10G 10 g

Irganox 1035

Sign In for Pricing
View Details