Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16ORF58 Peptide - middle region

C16ORF58 Peptide - middle region

Product Specifications

Product Name Alternative

RUS

UniProt

Q96GQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CFTMTVSTSNLAKCIVSVAGGATRAALTVHQARRNNMADVSAKDSSQETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tris-NTA Trifluoroacetic Acid Salt
TRC-N925005-1MG 1 mg

tris-NTA Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Blonanserin N-Oxide
TRC-B595853-25MG 25 mg

Blonanserin N-Oxide

Sign In for Pricing
View Details
Sarcalumenin (SRL) (NM_001098814) Human Over-expression Lysate
LY420346 100 µg

Sarcalumenin (SRL) (NM_001098814) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin
ICH1037-50mg 50 mg

Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
AP21001PU-N 100 µg

VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX8 Antibody
KC-21652-01 50 μL

SOX8 Antibody

Sign In for Pricing
View Details