Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMDHD2 Peptide - middle region

AMDHD2 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-14

UniProt

Q9Y303

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trfp (BC060122) Mouse Recombinant Protein
PM48839M5 20 µg

Trfp (BC060122) Mouse Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal DFF40/CAD Antibody
NBP2-55648-25ul 25 µL

Rabbit Polyclonal DFF40/CAD Antibody

Sign In for Pricing
View Details
BMP5 Blocking Peptide
MBS9616867-01 1 mg

BMP5 Blocking Peptide

Sign In for Pricing
View Details
BMP5 Blocking Peptide
MBS9616867-02 5x 1 mg

BMP5 Blocking Peptide

Sign In for Pricing
View Details
RPL17 Antibody, FITC conjugated
A37548-50UG 50 µg

RPL17 Antibody, FITC conjugated

Sign In for Pricing
View Details
Cytokeratin 18 (h) -PR
sc-35151-PR 10 µM - 20 µL

Cytokeratin 18 (h) -PR

Sign In for Pricing
View Details