Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMDHD2 Peptide - middle region

AMDHD2 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-14

UniProt

Q9Y303

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139287.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Acyl coenzyme A synthetase ACSM1, mitochondrial (ACSM1) ELISA Kit
GTR10332352 96 Well

Mouse Acyl coenzyme A synthetase ACSM1, mitochondrial (ACSM1) ELISA Kit

Sign In for Pricing
View Details
Goat anti-UBE2C / UBCH10 Antibody
dAP-0136 50 µg

Goat anti-UBE2C / UBCH10 Antibody

Sign In for Pricing
View Details
1700024P16Rik 3'UTR Lenti-reporter-Luc Vector
10199084 1.0 µg

1700024P16Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
S100A1, CT (S100A1, S100A, Protein S100-A1, S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1)
041353 200 µL

S100A1, CT (S100A1, S100A, Protein S100-A1, S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1)

Sign In for Pricing
View Details
FMO2 Rabbit Polyclonal Antibody
orb584944 100 µL

FMO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Immunoglobulin G4 (IgG4) Antibody
abx176920-01 100 µL

Immunoglobulin G4 (IgG4) Antibody

Sign In for Pricing
View Details