Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAL1 Peptide - middle region

TIAL1 Peptide - middle region

Product Specifications

Product Name Alternative

TCBP, TIAR

UniProt

Q01085

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001029097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EITH-L-GB-DOM-2A Scafftag Tagging System Kits
308822 1 Kit (1 Kit x 1 Kit)

EITH-L-GB-DOM-2A Scafftag Tagging System Kits

Sign In for Pricing
View Details
Human IL-31  ELISA Kit
LF-EK50995 1×96T

Human IL-31 ELISA Kit

Sign In for Pricing
View Details
AP4E1 (NM_001252127) Human Tagged ORF Clone
RC233195 10 µg

AP4E1 (NM_001252127) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-Cyclin B1 (Ser126) Rabbit Polyclonal Antibody (BF680)
orb1590321 100 µL

Phospho-Cyclin B1 (Ser126) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PLGA-PEG-Lys-Pro-Val-NH2
S01YF-0823-KX698 Each

PLGA-PEG-Lys-Pro-Val-NH2

Sign In for Pricing
View Details
ICA 512/PTPRN Rabbit Monoclonal Antibody
E56G2682 100 µL

ICA 512/PTPRN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details