TIAL1 Peptide - middle region
TIAL1 Peptide - middle region
Product Specifications
Product Name Alternative
TCBP, TIAR
UniProt
Q01085
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001029097.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CST 12041T 20 µL
Glucocorticoid Receptor (D6H2L) XP® Rabbit Monoclonal Antibody
Sign In for Pricing
View Details 
RK01433 96 Tests
Human Glutamic acid decarboxylase 65 (GAD65) ELISA Kit
Sign In for Pricing
View Details GTR15110711 1 Vial
Lentiviral mouse Sdr9c7 shRNA (UAS) - Lentiviral mouse Sdr9c7 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details MBS6263703-01 0.1 mL
CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Human T & NK Cells) (MaxLight 490)
Sign In for Pricing
View Details MBS6263703-02 5x 0.1 mL
CD2 (E Rosette Receptor, T11, Lymphocyte Function Antigen 2, LFA-2, Human T & NK Cells) (MaxLight 490)
Sign In for Pricing
View Details