Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRADD Peptide - N-terminal region

TRADD Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hs.89862

UniProt

Q15628

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001310481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adam8 activation kit by CRISPRa
GA200071 1 Kit

Mouse Adam8 activation kit by CRISPRa

Sign In for Pricing
View Details
rac-trans-[3-Hydroxycyclohexyl]benzamide
TRC-H827010-10MG 10 mg

rac-trans-[3-Hydroxycyclohexyl]benzamide

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL
BNC040489-100 1x 100 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem128 Mouse Gene Knockout Kit (CRISPR)
KN517713 1 Kit

Tmem128 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tretazicar (>94%)
TRC-T719800-500MG 500 mg

Tretazicar (>94%)

Sign In for Pricing
View Details
MCM7 Polyclonal Antibody
E-AB-40231-01 25 µL

MCM7 Polyclonal Antibody

Sign In for Pricing
View Details