Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRADD Peptide - N-terminal region

TRADD Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hs.89862

UniProt

Q15628

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001310481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-chloro-2,1,3-benzoxadiazol-4-amine
TRC-C413385-25MG 25 mg

5-chloro-2,1,3-benzoxadiazol-4-amine

Sign In for Pricing
View Details
Mouse Fn1 activation kit by CRISPRa
GA201457 1 Kit

Mouse Fn1 activation kit by CRISPRa

Sign In for Pricing
View Details
Col7a1 (NC1 FN-III-like Dom 7+8) Rabbit Polyclonal Antibody
AP23438PU-S 10 µg

Col7a1 (NC1 FN-III-like Dom 7+8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Meig1 (NM_008579) Mouse Tagged ORF Clone
MG200210 10 µg

Meig1 (NM_008579) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091,  20nm
GM-201-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG1 HP6091, 20nm

Sign In for Pricing
View Details
HABP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]
TA809360BM 100 µL

HABP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details