Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPHK1 Peptide - middle region

SPHK1 Peptide - middle region

Product Specifications

Product Name Alternative

SPHK

UniProt

Q9NYA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001136073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM Kinase 1 Recombinant Rabbit monoclonal Antibody
HA751233 100 µL

LIM Kinase 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Kelch like protein 34 (KLHL34) Human Gene Knockout Kit (CRISPR)
KN420232 1 Kit

Kelch like protein 34 (KLHL34) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calr Mouse Gene Knockout Kit (CRISPR)
KN502469 1 Kit

Calr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TdT Rabbit Polyclonal Antibody
0807-4 100 µL

TdT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-01 50 μL

NSF Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-02 100 µL

NSF Antibody

Sign In for Pricing
View Details