Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPHK1 Peptide - middle region

SPHK1 Peptide - middle region

Product Specifications

Product Name Alternative

SPHK

UniProt

Q9NYA1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001136073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

n-Propyltriphenylphosphonium-d5 Bromide
TRC-P838392-250MG 250 mg

n-Propyltriphenylphosphonium-d5 Bromide

Sign In for Pricing
View Details
HSPA9 Polyclonal Antibody
E-AB-15085-01 20 µL

HSPA9 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA9 Polyclonal Antibody
E-AB-15085-02 60 µL

HSPA9 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA9 Polyclonal Antibody
E-AB-15085-03 120 µL

HSPA9 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA9 Polyclonal Antibody
E-AB-15085-04 200 µL

HSPA9 Polyclonal Antibody

Sign In for Pricing
View Details
Amoxicilloic Acid Dimer (Mixture of Diastereomers)
TRC-A612475-5MG 5 mg

Amoxicilloic Acid Dimer (Mixture of Diastereomers)

Sign In for Pricing
View Details