What is the catalog number for MCM5 Peptide - middle region?

The catalog number for MCM5 Peptide - middle region is orb1998943.

What sizes are available for MCM5 Peptide - middle region?

MCM5 Peptide - middle region is available in the following size(s): 100 µg.

Is MCM5 Peptide - middle region in stock?

MCM5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MCM5 Peptide - middle region

Product Specifications

Product Name Alternative

CDC46, P1-CDC46

UniProt

P33992

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006730.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RC402776 10 µg

c Maf (MAF) (NM_005360) Human Mutant ORF Clone

Sign In for Pricing

View Details

sc-150284-SH 20 µg

Olfr1109 shRNA Plasmid (m)

Sign In for Pricing

View Details

ESG0248 96 Tests

Sheep Grb10 ELISA Kit

Sign In for Pricing

View Details

E105233 1 Each

Chicken RET4 ELISA Kit

Sign In for Pricing

View Details

bs-4888R-APC-Cy7 100 µL

Phospho-PPAR Gamma (ser273) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing

View Details

SI110116B 1 Each

Mouse Park7 Pre-designed siRNA Set B

Sign In for Pricing

View Details