MCM5 Peptide - middle region
MCM5 Peptide - middle region
Product Specifications
Product Name Alternative
CDC46, P1-CDC46
UniProt
P33992
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006730.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2609904-01 48 Well
Bovine Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details MBS2609904-02 96 Well
Bovine Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details MBS2609904-03 5x 96 Well
Bovine Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details MBS2609904-04 10x 96 Well
Bovine Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details 