Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXN Peptide - middle region

NXN Peptide - middle region

Product Specifications

Product Name Alternative

NRX, TRG-4

UniProt

Q6DKJ4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001192248.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIG2 (HILPDA) (NM_001098786) Human Over-expression Lysate
LC420675 20 µg

HIG2 (HILPDA) (NM_001098786) Human Over-expression Lysate

Sign In for Pricing
View Details
Pyridoxol 5'-Phosphate >90%
TRC-P991780-10MG 10 mg

Pyridoxol 5'-Phosphate >90%

Sign In for Pricing
View Details
Recombinant Human DHPS Protein (His Tag)
PKSH032349-01 10 µg

Recombinant Human DHPS Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DHPS Protein (His Tag)
PKSH032349-02 50 µg

Recombinant Human DHPS Protein (His Tag)

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker), Biotin conjugate, 0.1mg/mL
BNCB1662-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL20 Receptor alpha (IL20RA) (NM_014432) Human Recombinant Protein
TP762236 50 µg

IL20 Receptor alpha (IL20RA) (NM_014432) Human Recombinant Protein

Sign In for Pricing
View Details