Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXN Peptide - middle region

NXN Peptide - middle region

Product Specifications

Product Name Alternative

NRX, TRG-4

UniProt

Q6DKJ4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001192248.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3’,4’-Dibenzyloxy-1-phenyl-2-butanone
TRC-D418015-50MG 50 mg

3’,4’-Dibenzyloxy-1-phenyl-2-butanone

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL
BNC041370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189H-01 50 Tests

PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189H-02 100 Tests

PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Recombinant PEDF Antibody
RC-14312-01 50 μL

Recombinant PEDF Antibody

Sign In for Pricing
View Details