EIF3I Peptide - C-terminal region
EIF3I Peptide - C-terminal region
Product Specifications
Product Name Alternative
TRIP1, EIF3S2, TRIP-1, PRO2242, eIF3-p36, eIF3-beta
UniProt
Q13347
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003748.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6430552-01 0.1 mL
PARD6B (Partitioning Defective 6 Homolog beta, PAR6B) (MaxLight 650)
Sign In for Pricing
View Details MBS6430552-02 5x 0.1 mL
PARD6B (Partitioning Defective 6 Homolog beta, PAR6B) (MaxLight 650)
Sign In for Pricing
View Details 
bs-17123R-PE-Cy5.5 100 µL
TRIM68 Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details