What is the catalog number for VIL1 Peptide - middle region?

The catalog number for VIL1 Peptide - middle region is orb1998887.

What sizes are available for VIL1 Peptide - middle region?

VIL1 Peptide - middle region is available in the following size(s): 100 µg.

Is VIL1 Peptide - middle region in stock?

VIL1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

VIL1 Peptide - middle region

Product Specifications

Product Name Alternative

VIL, D2S1471

UniProt

P09327

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009058.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEPPHLMSIFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E917537 100 µL

TBCC Polyclonal Antibody

Sign In for Pricing

View Details

LC401472 20 µg

CDK2AP1 (NM_004642) Human Over-expression Lysate

Sign In for Pricing

View Details

NBP2-74597DL594 0.1 mL

Mouse Monoclonal TRIB2 Antibody (OTI8D11) [Dylight 594]

Sign In for Pricing

View Details

EAA27193-01 100 mg

N- (2-Cyanoethyl) -N- (propan-2-yl) acetamide

Sign In for Pricing

View Details

EAA27193-02 1 g

N- (2-Cyanoethyl) -N- (propan-2-yl) acetamide

Sign In for Pricing

View Details

STJ96375 200 µl

Anti-beta-1,4-Gal-T5 antibody

Sign In for Pricing

View Details