VIL1 Peptide - middle region
VIL1 Peptide - middle region
Product Specifications
Product Name Alternative
VIL, D2S1471
UniProt
P09327
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_009058.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEPPHLMSIFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8585886-02 0.1 mL (AF405L)
Neu (phospho Thr686) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585886-03 0.1 mL (AF405S)
Neu (phospho Thr686) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585886-04 0.1 mL (AF610)
Neu (phospho Thr686) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585886-05 0.1 mL (AF635)
Neu (phospho Thr686) Polyclonal Antibody
Sign In for Pricing
View Details MBS8585886-06 0.1 mL (APC)
Neu (phospho Thr686) Polyclonal Antibody
Sign In for Pricing
View Details