Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NARS2 Peptide - middle region

NARS2 Peptide - middle region

Product Specifications

Product Name Alternative

SLM5, asnRS, DFNB94

UniProt

Q96I59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2a Mouse Gene Knockout Kit (CRISPR)
KN518562 1 Kit

Ube2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human ADPRH/ARH1 Protein (His Tag)
PKSH032047-01 10 µg

Recombinant Human ADPRH/ARH1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ADPRH/ARH1 Protein (His Tag)
PKSH032047-02 50 µg

Recombinant Human ADPRH/ARH1 Protein (His Tag)

Sign In for Pricing
View Details
INDOL1 (IDO2) (NM_194294) Human Over-expression Lysate
LY403659 100 µg

INDOL1 (IDO2) (NM_194294) Human Over-expression Lysate

Sign In for Pricing
View Details
Vimentin Antibody
8C0390-AAT 50 µg

Vimentin Antibody

Sign In for Pricing
View Details
Chmp3 Mouse Gene Knockout Kit (CRISPR)
KN503279 1 Kit

Chmp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details