Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NARS2 Peptide - middle region

NARS2 Peptide - middle region

Product Specifications

Product Name Alternative

SLM5, asnRS, DFNB94

UniProt

Q96I59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230180.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEAB (CLP1) Mouse Monoclonal Antibody [Clone ID: OTI1H7]
CF809653 100 µg

HEAB (CLP1) Mouse Monoclonal Antibody [Clone ID: OTI1H7]

Sign In for Pricing
View Details
Human IRS2 activation kit by CRISPRa
GA105740 1 Kit

Human IRS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
RD-ANGPTL3-Hu-01 96 Tests

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
RD-ANGPTL3-Hu-02 48 Tests

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Phthalic-13C6 Anhydride
TRC-P384489-50MG 50 mg

Phthalic-13C6 Anhydride

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD18 Antibody[60.3]
E-AB-F1412P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD18 Antibody[60.3]

Sign In for Pricing
View Details