Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Peptide - C-terminal region

SLC35E1 Peptide - C-terminal region

Product Specifications

UniProt

Q96K37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079157.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR562499 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
6-Aminohexanoic Acid Hydrochloride
TRC-A603015-5G 5 g

6-Aminohexanoic Acid Hydrochloride

Sign In for Pricing
View Details
TTC11 (FIS1) (NM_016068) Human Over-expression Lysate
LY402496 100 µg

TTC11 (FIS1) (NM_016068) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Pank1 activation kit by CRISPRa
GA210329 1 Kit

Mouse Pank1 activation kit by CRISPRa

Sign In for Pricing
View Details
ROBO2 (NM_001128929) Human Over-expression Lysate
LC427030 20 µg

ROBO2 (NM_001128929) Human Over-expression Lysate

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid
TRC-H294375-250MG 250 mg

(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid

Sign In for Pricing
View Details