Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Peptide - C-terminal region

SLC35E1 Peptide - C-terminal region

Product Specifications

UniProt

Q96K37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079157.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Interleukin-27/IL-27 Protein (His Tag)
PKSM041088-01 10 µg

Recombinant Mouse Interleukin-27/IL-27 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-27/IL-27 Protein (His Tag)
PKSM041088-02 50 µg

Recombinant Mouse Interleukin-27/IL-27 Protein (His Tag)

Sign In for Pricing
View Details
TRPML3 Rabbit Polyclonal Antibody
ER1901-21 100 µL

TRPML3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
BNC470902-100 1x 100 µL

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bis(maltolato)oxovanadium(IV)
TRC-B478500-250MG 250 mg

Bis(maltolato)oxovanadium(IV)

Sign In for Pricing
View Details
Cyanine 3 monosuccinimidyl ester, potassium salt [same as GE Cy3® NHS ester]
271-AAT 1 mg

Cyanine 3 monosuccinimidyl ester, potassium salt [same as GE Cy3® NHS ester]

Sign In for Pricing
View Details