Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUT Peptide - middle region

MUT Peptide - middle region

Product Specifications

Product Name Alternative

MCM

UniProt

P22033

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000246.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-TA Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV734332 1.0 µg DNA

MT-TA Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Neurokin B receptor Rabbit Polyclonal Antibody (BF680)
orb1573669 100 µL

Neurokin B receptor Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CD14 Ab Magbeads
E601AB005 ~ 2x 10^9 Cells - 1 mL

CD14 Ab Magbeads

Sign In for Pricing
View Details
Human PDCL3 antibody
ATGA0333-050 50 µL

Human PDCL3 antibody

Sign In for Pricing
View Details
RGD1563159 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV643147 1.0 µg DNA

RGD1563159 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Goat Complement fragment 4a ELISA kit
GTR10468670 96 Well

Goat Complement fragment 4a ELISA kit

Sign In for Pricing
View Details