MUT Peptide - middle region
MUT Peptide - middle region
Product Specifications
Product Name Alternative
MCM
UniProt
P22033
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000246.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: THRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
043297-AP 200 µL
TRPV4, NT (TRPV4, VRL2, VROAC, Transient receptor potential cation channel subfamily V member 4, Osm-9-like TRP channel 4, Transient receptor potential protein 12, Vanilloid receptor-like channel 2, Vanilloid receptor-like protein 2, Vanilloid receptor-related osmotically-activated channel) (AP) discontinued
Sign In for Pricing
View Details 
MBS9002048 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At3g59210 Polyclonal Antibody
Sign In for Pricing
View Details TA424822S 20 µL
GLO1 Rabbit Monoclonal Antibody [Clone ID: 23GB5555]
Sign In for Pricing
View Details 
75-242-FL490 200 µL
Anti-TARPGamma2/Stargazin Antibody FL490 Conjugate
Sign In for Pricing
View Details